Lineage for d1qjta_ (1qjt A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3442Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (1 protein)
  6. 3443Protein Eps15 [47544] (2 species)
  7. 3449Species Mouse (Mus musculus) [TaxId:10090] [47545] (1 PDB entry)
  8. 3450Domain d1qjta_: 1qjt A: [17335]

Details for d1qjta_

PDB Entry: 1qjt (more details)

PDB Description: solution structure of the apo eh1 domain of mouse epidermal growth factor receptor substrate 15, eps15

SCOP Domain Sequences for d1qjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus)}
lsltqlssgnpvyekyyrqveagntgrvlaldaaaflkksglpdlilgkiwdladtdgkg
vlskqeffvalrlvacaqnglevslsslslavppprfhd

SCOP Domain Coordinates for d1qjta_:

Click to download the PDB-style file with coordinates for d1qjta_.
(The format of our PDB-style files is described here.)

Timeline for d1qjta_: