| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins) |
| Protein automated matches [191018] (1 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [188798] (2 PDB entries) |
| Domain d3cn7b_: 3cn7 B: [173348] automated match to d1auoa_ complexed with mes |
PDB Entry: 3cn7 (more details), 2.99 Å
SCOPe Domain Sequences for d3cn7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cn7b_ c.69.1.14 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
seplildapnadaciiwlhglgadrtdfkpvaealqmvlpstrfilpqapsqavtvnggw
vmpswydilafsparaidedqlnasadqvialideqrakgiaaeriilagfsqggavvlh
tafrryaqplggvlalstyaptfddlalderhkripvlhlhgsqddvvdpalgraahdal
qaqgvevgwhdypmghevsleeihdigawlrkrl
Timeline for d3cn7b_: