SCOPe 2.05: Domain d3cn2b_: 3cn2 B:

Lineage for d3cn2b_ (3cn2 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (234 PDB entries)
   Uniprot P02766 31-143

8. Domain d3cn2b_: 3cn2 B: [173342]
   automated match to d1eta1_
   complexed with lj3

Details for d3cn2b_

PDB Entry: 3cn2, 1.52 Å

PDB Description: Human transthyretin (TTR) in complex with 3,5-Dibromo-4-hydroxybiphenyl

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3cn2b_:

Sequence; same for both SEQRES and ATOM records:

>d3cn2b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d3cn2b_:

• d3cn2b_ first appeared in SCOPe 2.01
  
• d3cn2b_ appears in SCOPe 2.04
  
• d3cn2b_ appears in SCOPe 2.06
  
• d3cn2b_ appears in the current release, SCOPe 2.08