Lineage for d1dgva_ (1dgv A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47644Protein Calium- and integrin-binding protein, CIB [47541] (1 species)
  7. 47645Species Human (Homo sapiens) [TaxId:9606] [47542] (2 PDB entries)
  8. 47647Domain d1dgva_: 1dgv A: [17334]

Details for d1dgva_

PDB Entry: 1dgv (more details)

PDB Description: homology-based model of apo cib (calcium-and integrin-binding protein)

SCOP Domain Sequences for d1dgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgva_ a.39.1.5 (A:) Calium- and integrin-binding protein, CIB {Human (Homo sapiens)}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

SCOP Domain Coordinates for d1dgva_:

Click to download the PDB-style file with coordinates for d1dgva_.
(The format of our PDB-style files is described here.)

Timeline for d1dgva_: