SCOPe 2.07: Domain d3cmya1: 3cmy A:1-59

Lineage for d3cmya1 (3cmy A:1-59)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)

8. Domain d3cmya1: 3cmy A:1-59 [173335]
   Other proteins in same PDB: d3cmya2
   automated match to d1fjla_
   protein/DNA complex; complexed with edo

Details for d3cmya1

PDB Entry: 3cmy, 1.95 Å

PDB Description: Structure of a homeodomain in complex with DNA

PDB Compounds: (A:) Paired box protein Pax-3

SCOPe Domain Sequences for d3cmya1:

Sequence; same for both SEQRES and ATOM records:

>d3cmya1 a.4.1.1 (A:1-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrrsrttftaeqleeleraferthypdiytreelaqrakltearvqvwfsnrrarwrkq

Timeline for d3cmya1:

• d3cmya1 first appeared in SCOPe 2.01, called d3cmya_
  
• d3cmya1 appears in SCOPe 2.06