| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein automated matches [190360] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries) |
| Domain d3cmya1: 3cmy A:1-59 [173335] Other proteins in same PDB: d3cmya2 automated match to d1fjla_ protein/DNA complex; complexed with edo |
PDB Entry: 3cmy (more details), 1.95 Å
SCOPe Domain Sequences for d3cmya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmya1 a.4.1.1 (A:1-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrrsrttftaeqleeleraferthypdiytreelaqrakltearvqvwfsnrrarwrkq
Timeline for d3cmya1: