SCOPe 2.06: Domain d1dgua_: 1dgu A:

Lineage for d1dgua_ (1dgu A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47542] (3 PDB entries)
   Uniprot Q99828

8. Domain d1dgua_: 1dgu A: [17333]

Details for d1dgua_

PDB Entry: 1dgu

PDB Description: homology-based model of calcium-saturated cib (calcium-and integrin- binding protein)

PDB Compounds: (A:) calcium-saturated cib

SCOPe Domain Sequences for d1dgua_:

Sequence; same for both SEQRES and ATOM records:

>d1dgua_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

Timeline for d1dgua_:

• d1dgua_ first appeared (with stable ids) in SCOP 1.55
  
• d1dgua_ appears in SCOPe 2.05
  
• d1dgua_ appears in SCOPe 2.07
  
• d1dgua_ appears in the current release, SCOPe 2.08