SCOPe 2.06: Domain d3cm2e_: 3cm2 E:

Lineage for d3cm2e_ (3cm2 E:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d3cm2e_: 3cm2 E: [173326]
   automated match to d1f9xa_
   complexed with x23, zn

Details for d3cm2e_

PDB Entry: 3cm2, 2.5 Å

PDB Description: Crystal Structure of XIAP BIR3 domain in complex with a Smac-mimetic compound, Smac010

PDB Compounds: (E:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3cm2e_:

Sequence; same for both SEQRES and ATOM records:

>d3cm2e_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsleeclvrt

Timeline for d3cm2e_:

• d3cm2e_ first appeared in SCOPe 2.01
  
• d3cm2e_ appears in SCOPe 2.05
  
• d3cm2e_ appears in SCOPe 2.07
  
• d3cm2e_ appears in the current release, SCOPe 2.08