Lineage for d3cm0a_ (3cm0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865760Species Thermus thermophilus [TaxId:274] [188607] (1 PDB entry)
  8. 2865761Domain d3cm0a_: 3cm0 A: [173321]
    automated match to d1p4sa_

Details for d3cm0a_

PDB Entry: 3cm0 (more details), 1.8 Å

PDB Description: Crystal structure of adenylate kinase from Thermus thermophilus HB8
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3cm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cm0a_ c.37.1.1 (A:) Adenylate kinase {Thermus thermophilus [TaxId: 274]}
vgqaviflgppgagkgtqasrlaqelgfkklstgdilrdhvargtplgervrpimergdl
vpddlilelireelaervifdgfprtlaqaealdrllsetgtrllgvvlvevpeeelvrr
ilrraelegrsddneetvrrrlevyrekteplvgyyeargvlkrvdglgtpdevyarira
algi

SCOPe Domain Coordinates for d3cm0a_:

Click to download the PDB-style file with coordinates for d3cm0a_.
(The format of our PDB-style files is described here.)

Timeline for d3cm0a_: