Lineage for d3clcd_ (3clc D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1489279Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1489280Protein automated matches [190907] (7 species)
    not a true protein
  7. 1489281Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 1489325Domain d3clcd_: 3clc D: [173312]
    automated match to d2b5ad1
    protein/DNA complex; complexed with mg

Details for d3clcd_

PDB Entry: 3clc (more details), 2.8 Å

PDB Description: Crystal Structure of the Restriction-Modification Controller Protein C.Esp1396I Tetramer in Complex with its Natural 35 Base-Pair Operator
PDB Compounds: (D:) Regulatory protein

SCOPe Domain Sequences for d3clcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clcd_ a.35.1.0 (D:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilk

SCOPe Domain Coordinates for d3clcd_:

Click to download the PDB-style file with coordinates for d3clcd_.
(The format of our PDB-style files is described here.)

Timeline for d3clcd_: