Lineage for d3cl7b_ (3cl7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850697Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 2850701Protein automated matches [190850] (3 species)
    not a true protein
  7. 2850715Species Pseudomonas fluorescens [TaxId:294] [188464] (3 PDB entries)
  8. 2850719Domain d3cl7b_: 3cl7 B: [173306]
    automated match to d1z7aa1
    complexed with hyn

Details for d3cl7b_

PDB Entry: 3cl7 (more details), 1.8 Å

PDB Description: Crystal structure of Puue Allantoinase in complex with Hydantoin
PDB Compounds: (B:) Puue allantoinase

SCOPe Domain Sequences for d3cl7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cl7b_ c.6.2.6 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
vdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsaqp
lqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaaghe
icshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeggf
lydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdafdv
lyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhathp
yt

SCOPe Domain Coordinates for d3cl7b_:

Click to download the PDB-style file with coordinates for d3cl7b_.
(The format of our PDB-style files is described here.)

Timeline for d3cl7b_: