Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.6: PA1517-like [141965] (2 proteins) seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522) |
Protein automated matches [190850] (3 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [188464] (3 PDB entries) |
Domain d3cl6b_: 3cl6 B: [173304] automated match to d1z7aa1 |
PDB Entry: 3cl6 (more details), 1.58 Å
SCOPe Domain Sequences for d3cl6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cl6b_ c.6.2.6 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]} vdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsaqp lqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaaghe icshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeggf lydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdafdv lyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhathp yt
Timeline for d3cl6b_: