Lineage for d3cl6a_ (3cl6 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979433Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 979485Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 979596Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 979600Protein automated matches [190850] (3 species)
    not a true protein
  7. 979614Species Pseudomonas fluorescens [TaxId:294] [188464] (3 PDB entries)
  8. 979615Domain d3cl6a_: 3cl6 A: [173303]
    automated match to d1z7aa1

Details for d3cl6a_

PDB Entry: 3cl6 (more details), 1.58 Å

PDB Description: Crystal structure of Puue Allantoinase
PDB Compounds: (A:) Puue allantoinase

SCOPe Domain Sequences for d3cl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cl6a_ c.6.2.6 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
vdyprdligygsnpphphwpgkarialsfvlnyeeggernilhgdkeseaflsemvsaqp
lqgernmsmeslyeygsragvwrilklfkafdipltifavamaaqrhpdviramvaaghe
icshgyrwidyqymdeaqerehmleairilteltgerplgwytgrtgpntrrlvmeeggf
lydcdtydddlpywepnnptgkphlvipytldtndmrftqvqgfnkgddffeylkdafdv
lyaegaeapkmlsiglhcrligrparlaalqrfieyaksheqvwftrrvdiarhwhathp
yt

SCOPe Domain Coordinates for d3cl6a_:

Click to download the PDB-style file with coordinates for d3cl6a_.
(The format of our PDB-style files is described here.)

Timeline for d3cl6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cl6b_