SCOPe 2.06: Domain d1jbaa_: 1jba A:

Lineage for d1jbaa_ (1jba A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Guanylate cyclase activating protein 2, GCAP-2 [47537] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47538] (1 PDB entry)

8. Domain d1jbaa_: 1jba A: [17330]
   complexed with ca

Details for d1jbaa_

PDB Entry: 1jba

PDB Description: unmyristoylated gcap-2 with three calcium ions bound

PDB Compounds: (A:) protein (guanylate cyclase activating protein 2)

SCOPe Domain Sequences for d1jbaa_:

Sequence; same for both SEQRES and ATOM records:

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}
gqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqyv
eamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldiv
esiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwvm
kmlqmdlnp

Timeline for d1jbaa_:

• d1jbaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1jbaa_ appears in SCOPe 2.05
  
• d1jbaa_ appears in SCOPe 2.07
  
• d1jbaa_ appears in the current release, SCOPe 2.08