Lineage for d1jbaa_ (1jba A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Guanylate cyclase activating protein 2, GCAP-2 [47537] (1 species) Species Cow (Bos taurus) [TaxId:9913] [47538] (1 PDB entry) 
Domain d1jbaa_: 1jba A: [17330]
Details for d1jbaa_
PDB Entry: 1jba (more details)
PDB Description: unmyristoylated gcap-2 with three calcium ions bound
SCOP Domain Sequences for d1jbaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus)}
gqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqyv
eamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldiv
esiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwvm
kmlqmdlnp
SCOP Domain Coordinates for d1jbaa_:
Click to download the PDB-style file with coordinates for d1jbaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jbaa_:
- d1jbaa_ appears in SCOP 1.57
- d1jbaa_ appears in the current release, SCOPe 2.08
View in 3D