Lineage for d1jbaa_ (1jba A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711032Protein Guanylate cyclase activating protein 2, GCAP-2 [47537] (1 species)
  7. 2711033Species Cow (Bos taurus) [TaxId:9913] [47538] (1 PDB entry)
  8. 2711034Domain d1jbaa_: 1jba A: [17330]
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1jbaa_

PDB Entry: 1jba (more details)

PDB Description: unmyristoylated gcap-2 with three calcium ions bound
PDB Compounds: (A:) protein (guanylate cyclase activating protein 2)

SCOPe Domain Sequences for d1jbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}
gqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqyv
eamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldiv
esiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwvm
kmlqmdlnp

SCOPe Domain Coordinates for d1jbaa_:

Click to download the PDB-style file with coordinates for d1jbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jbaa_: