Lineage for d1fpwa_ (1fpw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711013Protein Frequenin (neuronal calcium sensor 1) [47535] (3 species)
  7. 2711014Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47536] (2 PDB entries)
  8. 2711015Domain d1fpwa_: 1fpw A: [17329]
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1fpwa_

PDB Entry: 1fpw (more details)

PDB Description: structure of yeast frequenin
PDB Compounds: (A:) calcium-binding protein ncs-1

SCOPe Domain Sequences for d1fpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgaktsklskddltclkqstyfdrreiqqwhkgflrdcpsgqlaredfvkiykqffpfgs
pedfanhlftvfdkdnngfihfeefitvlsttsrgtleeklswafelydlnhdgyitfde
mltivasvykmmgsmvtlnedeatpemrvkkifklmdknedgyitldefregskvdpsii
galnlydgli

SCOPe Domain Coordinates for d1fpwa_:

Click to download the PDB-style file with coordinates for d1fpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1fpwa_: