Lineage for d3ckha_ (3ckh A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530274Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1530288Protein automated matches [190969] (1 species)
    not a true protein
  7. 1530289Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 1530312Domain d3ckha_: 3ckh A: [173287]
    automated match to d1kgya_

Details for d3ckha_

PDB Entry: 3ckh (more details), 2.8 Å

PDB Description: crystal structure of eph a4 receptor
PDB Compounds: (A:) Ephrin type-A receptor 4

SCOPe Domain Sequences for d3ckha_:

Sequence, based on SEQRES records: (download)

>d3ckha_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti
aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfyk

Sequence, based on observed residues (ATOM records): (download)

>d3ckha_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsideknirtyqvcnvmepsqnnwlrtdwitr
egaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidtiaad
esftqvdigrimklnteirdvgplskkgfylafqdvgacialvsvrvfyk

SCOPe Domain Coordinates for d3ckha_:

Click to download the PDB-style file with coordinates for d3ckha_.
(The format of our PDB-style files is described here.)

Timeline for d3ckha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ckhb_