SCOPe 2.08: Domain d3ckga1: 3ckg A:27-258

Lineage for d3ckga1 (3ckg A:27-258)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.1: Outer surface protein [51087] (1 family)
   21 stranded sheet partly folded upon itself at the ends

5. Family b.76.1.1: Outer surface protein [51088] (3 proteins)

6. Protein automated matches [190440] (3 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (24 PDB entries)

8. Domain d3ckga1: 3ckg A:27-258 [173286]
   Other proteins in same PDB: d3ckga2
   automated match to d1fj1e_
   complexed with mg; mutant

Details for d3ckga1

PDB Entry: 3ckg, 1.8 Å

PDB Description: the crystal structure of ospa deletion mutant

PDB Compounds: (A:) Outer surface protein A

SCOPe Domain Sequences for d3ckga1:

Sequence; same for both SEQRES and ATOM records:

>d3ckga1 b.76.1.1 (A:27-258) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
knsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskv
kltisddlgqttlevfksdgstlvskkvtsngssteeradgtrleytgiksdgsgkakev
lkgyvlegtltaekttlvvkegtvtlsknisksgevsvelndtdssaatkktaawnsgts
tltitvnskktkdlvftssntitvqqydsngtslegsaveitkldeiknalk

Timeline for d3ckga1:

• d3ckga1 first appeared in SCOPe 2.01, called d3ckga_
  
• d3ckga1 appears in SCOPe 2.07