Lineage for d3ckfa_ (3ckf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557223Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1557224Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 1557225Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 1557235Protein automated matches [190440] (1 species)
    not a true protein
  7. 1557236Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (13 PDB entries)
  8. 1557240Domain d3ckfa_: 3ckf A: [173285]
    automated match to d1fj1e_
    mutant

Details for d3ckfa_

PDB Entry: 3ckf (more details), 1.25 Å

PDB Description: the crystal structure of ospa deletion mutant
PDB Compounds: (A:) Outer surface protein A

SCOPe Domain Sequences for d3ckfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ckfa_ b.76.1.1 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtradgtrleytgiksdgsgkakevlkgyvlegt
ltaekttlvvkegtvtlsknisksgevsvelndtdssaatkktaawnsgtstltitvnsk
ktkdlvftssntitvqqydsngtslegsaveitkldeiknalk

SCOPe Domain Coordinates for d3ckfa_:

Click to download the PDB-style file with coordinates for d3ckfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ckfa_: