Lineage for d1jsa__ (1jsa -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97470Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 97599Protein Recoverin [47533] (1 species)
  7. 97600Species Cow (Bos taurus) [TaxId:9913] [47534] (3 PDB entries)
  8. 97603Domain d1jsa__: 1jsa - [17328]

Details for d1jsa__

PDB Entry: 1jsa (more details)

PDB Description: myristoylated recoverin with two calciums bound, nmr, 24 structures

SCOP Domain Sequences for d1jsa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsa__ a.39.1.5 (-) Recoverin {Cow (Bos taurus)}
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfe

SCOP Domain Coordinates for d1jsa__:

Click to download the PDB-style file with coordinates for d1jsa__.
(The format of our PDB-style files is described here.)

Timeline for d1jsa__: