Lineage for d1jsa__ (1jsa -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (15 proteins) 
Protein Recoverin [47533] (1 species) Species Cow (Bos taurus) [TaxId:9913] [47534] (3 PDB entries) 
Domain d1jsa__: 1jsa - [17328]
Details for d1jsa__
PDB Entry: 1jsa (more details)
PDB Description: myristoylated recoverin with two calciums bound, nmr, 24 structures
SCOP Domain Sequences for d1jsa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jsa__ a.39.1.5 (-) Recoverin {Cow (Bos taurus)}
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfe
SCOP Domain Coordinates for d1jsa__:
Click to download the PDB-style file with coordinates for d1jsa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jsa__:
- d1jsa__ first appeared (with stable ids) in SCOP 1.55
- d1jsa__ appears in SCOP 1.59
- d1jsa__ appears in the current release, SCOPe 2.08, called d1jsaa_
View in 3D