Lineage for d3cjka1 (3cjk A:2-68)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953870Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2953902Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (17 PDB entries)
    Uniprot O00244
  8. 2953911Domain d3cjka1: 3cjk A:2-68 [173279]
    Other proteins in same PDB: d3cjka2, d3cjkb1, d3cjkb2
    automated match to d1fe0b_
    complexed with cd

Details for d3cjka1

PDB Entry: 3cjk (more details), 1.8 Å

PDB Description: Crystal structure of the adduct HAH1-Cd(II)-MNK1.
PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d3cjka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cjka1 d.58.17.1 (A:2-68) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

SCOPe Domain Coordinates for d3cjka1:

Click to download the PDB-style file with coordinates for d3cjka1.
(The format of our PDB-style files is described here.)

Timeline for d3cjka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cjka2