SCOPe 2.08: Domain d1ikua_: 1iku A:

Lineage for d1ikua_ (1iku A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Recoverin [47533] (1 species)
   Calcium-myristoyl switch; only one EF-hand is functional

7. Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)

8. Domain d1ikua_: 1iku A: [17327]
   complexed with myr
   has additional insertions and/or extensions that are not grouped together

Details for d1ikua_

PDB Entry: 1iku

PDB Description: myristoylated recoverin in the calcium-free state, nmr, 22 structures

PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1ikua_:

Sequence; same for both SEQRES and ATOM records:

>d1ikua_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfe

Timeline for d1ikua_:

• d1ikua_ first appeared (with stable ids) in SCOP 1.55, called d1iku__
  
• d1ikua_ appears in SCOPe 2.07