Lineage for d3ciqk_ (3ciq K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2356957Species Human (Homo sapiens) [TaxId:9606] [88602] (475 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2357548Domain d3ciqk_: 3ciq K: [173262]
    automated match to d1a9bb_
    complexed with cu, tla

Details for d3ciqk_

PDB Entry: 3ciq (more details), 2.9 Å

PDB Description: a regulatable switch mediates self-association in an immunoglobulin fold
PDB Compounds: (K:) Beta-2-microglobulin

SCOPe Domain Sequences for d3ciqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciqk_ b.1.1.2 (K:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr

SCOPe Domain Coordinates for d3ciqk_:

Click to download the PDB-style file with coordinates for d3ciqk_.
(The format of our PDB-style files is described here.)

Timeline for d3ciqk_: