Lineage for d1rec__ (1rec -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47740Protein Recoverin [47533] (1 species)
  7. 47741Species Cow (Bos taurus) [TaxId:9913] [47534] (3 PDB entries)
  8. 47742Domain d1rec__: 1rec - [17326]

Details for d1rec__

PDB Entry: 1rec (more details), 1.9 Å

PDB Description: three-dimensional structure of recoverin, a calcium sensor in vision

SCOP Domain Sequences for d1rec__:

Sequence, based on SEQRES records: (download)

>d1rec__ a.39.1.5 (-) Recoverin {Cow (Bos taurus)}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
epqkvkeklk

Sequence, based on observed residues (ATOM records): (download)

>d1rec__ a.39.1.5 (-) Recoverin {Cow (Bos taurus)}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivtaifkmi
spedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfepqkv
keklk

SCOP Domain Coordinates for d1rec__:

Click to download the PDB-style file with coordinates for d1rec__.
(The format of our PDB-style files is described here.)

Timeline for d1rec__: