SCOPe 2.01: Domain d3cina2: 3cin A:210-316

Lineage for d3cina2 (3cin A:210-316)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Hypothetical protein TM1419 [103105] (1 species)
   myo-inositol 1-phosphate synthase-related protein

7. Species Thermotoga maritima [TaxId:2336] [103106] (1 PDB entry)

8. Domain d3cina2: 3cin A:210-316 [173251]
   Other proteins in same PDB: d3cina1
   structural genomics
   complexed with cl, mg, nad

Details for d3cina2

PDB Entry: 3cin, 1.7 Å

PDB Description: crystal structure of a myo-inositol-1-phosphate synthase-related protein (tm_1419) from thermotoga maritima msb8 at 1.70 a resolution

PDB Compounds: (A:) Myo-inositol-1-phosphate synthase-related protein

SCOPe Domain Sequences for d3cina2:

Sequence; same for both SEQRES and ATOM records:

>d3cina2 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
atgatpftadvlshlaqrnryvkdvaqfniggnmdflaltddgknkskeftkssivkdil
gydaphyikptgyleplgdkkfiaihieyvsfngatdelmingrind

Timeline for d3cina2:

• d3cina2 is new in SCOPe 2.01-stable
  
• d3cina2 appears in SCOPe 2.02
  
• d3cina2 appears in the current release, SCOPe 2.08