Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Hypothetical protein TM1419 [103105] (1 species) myo-inositol 1-phosphate synthase-related protein |
Species Thermotoga maritima [TaxId:2336] [103106] (2 PDB entries) |
Domain d3cina2: 3cin A:210-316 [173251] Other proteins in same PDB: d3cina1, d3cina3 structural genomics complexed with cl, mg, nad |
PDB Entry: 3cin (more details), 1.7 Å
SCOPe Domain Sequences for d3cina2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cina2 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} atgatpftadvlshlaqrnryvkdvaqfniggnmdflaltddgknkskeftkssivkdil gydaphyikptgyleplgdkkfiaihieyvsfngatdelmingrind
Timeline for d3cina2: