Lineage for d1auib_ (1aui B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710553Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)
  7. 2710556Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries)
  8. 2710558Domain d1auib_: 1aui B: [17325]
    Other proteins in same PDB: d1auia_
    complexed with ca, fe, zn

Details for d1auib_

PDB Entry: 1aui (more details), 2.1 Å

PDB Description: human calcineurin heterodimer
PDB Compounds: (B:) serine/threonine phosphatase 2b

SCOPe Domain Sequences for d1auib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd
gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk
dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv

SCOPe Domain Coordinates for d1auib_:

Click to download the PDB-style file with coordinates for d1auib_.
(The format of our PDB-style files is described here.)

Timeline for d1auib_: