SCOPe 2.03: Domain d3cikg_: 3cik G:

Lineage for d3cikg_ (3cik G:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (18 PDB entries)

8. Domain d3cikg_: 3cik G: [173249]
   Other proteins in same PDB: d3cikb_
   automated match to d1omwg_
   complexed with mg

Details for d3cikg_

PDB Entry: 3cik, 2.75 Å

PDB Description: Human GRK2 in Complex with Gbetagamma subunits

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3cikg_:

Sequence; same for both SEQRES and ATOM records:

>d3cikg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

Timeline for d3cikg_:

• d3cikg_ first appeared in SCOPe 2.01
  
• d3cikg_ appears in SCOPe 2.02
  
• d3cikg_ appears in SCOPe 2.04
  
• d3cikg_ appears in the current release, SCOPe 2.08