![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
![]() | Protein automated matches [190652] (6 species) not a true protein |
![]() | Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
![]() | Domain d3ci4a_: 3ci4 A: [173247] automated match to d1rtyb_ complexed with atp, cby, k, mg |
PDB Entry: 3ci4 (more details), 2 Å
SCOPe Domain Sequences for d3ci4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci4a_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]} vkiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnele eiqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtql asalhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmly rnskdvf
Timeline for d3ci4a_: