| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
| Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
| Protein automated matches [190652] (6 species) not a true protein |
| Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
| Domain d3ci4a1: 3ci4 A:2-187 [173247] Other proteins in same PDB: d3ci4a2 automated match to d1rtyb_ complexed with atp, cby, k, mg |
PDB Entry: 3ci4 (more details), 2 Å
SCOPe Domain Sequences for d3ci4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci4a1 a.25.2.0 (A:2-187) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
nskdvf
Timeline for d3ci4a1: