Lineage for d3ci3a1 (3ci3 A:2-188)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705281Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2705282Protein automated matches [190652] (6 species)
    not a true protein
  7. 2705307Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries)
  8. 2705308Domain d3ci3a1: 3ci3 A:2-188 [173246]
    Other proteins in same PDB: d3ci3a2
    automated match to d1rtyb_
    complexed with 3po, 5ad, b12, mg, na

Details for d3ci3a1

PDB Entry: 3ci3 (more details), 1.11 Å

PDB Description: Structure of the PduO-type ATP:co(I)rrinoid adenosyltransferase from Lactobacillus reuteri complexed with partial adenosylcobalamin and PPPi
PDB Compounds: (A:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d3ci3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
nskdvfr

SCOPe Domain Coordinates for d3ci3a1:

Click to download the PDB-style file with coordinates for d3ci3a1.
(The format of our PDB-style files is described here.)

Timeline for d3ci3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ci3a2