| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
| Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
| Protein automated matches [190652] (6 species) not a true protein |
| Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
| Domain d3ci3a1: 3ci3 A:2-188 [173246] Other proteins in same PDB: d3ci3a2 automated match to d1rtyb_ complexed with 3po, 5ad, b12, mg, na |
PDB Entry: 3ci3 (more details), 1.11 Å
SCOPe Domain Sequences for d3ci3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
nskdvfr
Timeline for d3ci3a1: