Lineage for d3cgzb_ (3cgz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973892Protein automated matches [190839] (4 species)
    not a true protein
  7. 2973897Species Salmonella typhimurium [TaxId:90371] [188434] (2 PDB entries)
  8. 2973899Domain d3cgzb_: 3cgz B: [173235]
    Other proteins in same PDB: d3cgza2
    automated match to d1id0a_

Details for d3cgzb_

PDB Entry: 3cgz (more details), 1.9 Å

PDB Description: Crystal Structure of Salmonella Sensor Kinase PhoQ catalytic domain
PDB Compounds: (B:) Virulence sensor histidine kinase phoQ

SCOPe Domain Sequences for d3cgzb_:

Sequence, based on SEQRES records: (download)

>d3cgzb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
relhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackyc
lefveisarqtddhlhifveddgpgiphskrslvfdrgqradtlrpgqgvglavareite
qyagqiiasdsllggarmevvfgrqh

Sequence, based on observed residues (ATOM records): (download)

>d3cgzb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
relhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackyc
lefveisarqtddhlhifveddgpgiphskrstlrpgqgvglavareiteqyagqiiasd
sllggarmevvfgrqh

SCOPe Domain Coordinates for d3cgzb_:

Click to download the PDB-style file with coordinates for d3cgzb_.
(The format of our PDB-style files is described here.)

Timeline for d3cgzb_: