Lineage for d3cgza_ (3cgz A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217156Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1217157Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1217440Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 1217487Protein automated matches [190839] (2 species)
    not a true protein
  7. 1217492Species Salmonella typhimurium [TaxId:90371] [188434] (2 PDB entries)
  8. 1217493Domain d3cgza_: 3cgz A: [173234]
    automated match to d1id0a_

Details for d3cgza_

PDB Entry: 3cgz (more details), 1.9 Å

PDB Description: Crystal Structure of Salmonella Sensor Kinase PhoQ catalytic domain
PDB Compounds: (A:) Virulence sensor histidine kinase phoQ

SCOPe Domain Sequences for d3cgza_:

Sequence, based on SEQRES records: (download)

>d3cgza_ d.122.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
svllsrelhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldn
ackyclefveisarqtddhlhifveddgpgiphskrslvfdrgqradtlrpgqgvglava
reiteqyagqiiasdsllggarmevvfgrqhptqkee

Sequence, based on observed residues (ATOM records): (download)

>d3cgza_ d.122.1.3 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
svllsrelhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldn
ackyclefveisarqtddhlhifveddgpgiphtlrpgqgvglavareiteqyagqiias
dsllggarmevvfgrqhptqkee

SCOPe Domain Coordinates for d3cgza_:

Click to download the PDB-style file with coordinates for d3cgza_.
(The format of our PDB-style files is described here.)

Timeline for d3cgza_: