SCOPe 2.08: Domain d3cgyb_: 3cgy B:

Lineage for d3cgyb_ (3cgy B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (4 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [188434] (2 PDB entries)

8. Domain d3cgyb_: 3cgy B: [173232]
   Other proteins in same PDB: d3cgya2
   automated match to d1id0a_
   complexed with rdc

Details for d3cgyb_

PDB Entry: 3cgy, 2.6 Å

PDB Description: Crystal Structure of Salmonella Sensor Kinase PhoQ catalytic domain in complex with radicicol

PDB Compounds: (B:) Virulence sensor histidine kinase phoQ

SCOPe Domain Sequences for d3cgyb_:

Sequence, based on SEQRES records:

>d3cgyb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
elhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackycl
efveisarqtddhlhifveddgpgiphskrslvfdrgqradtlrpgqgvglavareiteq
yagqiiasdsllggarmevvfgrqh

Sequence, based on observed residues (ATOM records):

>d3cgyb_ d.122.1.3 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
elhpvaplldnlisalnkvyqrkgvnismdispeisfvgeqndfvevmgnvldnackycl
efveisarqtddhlhifveddgpgiphglavareiteqyagqiiasdsllggarmevvfg
rqh

Timeline for d3cgyb_:

• d3cgyb_ first appeared in SCOPe 2.01
  
• d3cgyb_ appears in SCOPe 2.07