Lineage for d3cgwa_ (3cgw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152021Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 2152022Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 2152023Family c.143.1.1: CofD-like [142339] (3 protein domains)
    Pfam PF01933; UPF0052
  6. 2152030Protein LPPG:FO 2-phospho-L-lactate transferase CofD [142340] (1 species)
  7. 2152031Species Methanosarcina mazei [TaxId:2209] [142341] (3 PDB entries)
    Uniprot Q8PVT6 1-309
  8. 2152040Domain d3cgwa_: 3cgw A: [173230]

Details for d3cgwa_

PDB Entry: 3cgw (more details), 3.1 Å

PDB Description: Crystal structure of 2-phospho-(S)-lactate transferase from Methanosarcina mazei. Northeast Structural Genomics Consortium target MaR46
PDB Compounds: (A:) LPPG:FO 2-phospho-L-lactate transferase

SCOPe Domain Sequences for d3cgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cgwa_ c.143.1.1 (A:) LPPG:FO 2-phospho-L-lactate transferase CofD {Methanosarcina mazei [TaxId: 2209]}
miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidr
krwwgiendtfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslf
gikanilpmsddpvstyietaegimhfqdfwigkrgepdvrgvdirgvseasispkvlea
fekeeniligpsnpitsigpiislpgmrellkkkkvvavspiignapvsgpagklmpacg
ievssmgvaeyyqdfldvfvfderdradefaferlgchasradtlmtstekskelaeivv
qaf

SCOPe Domain Coordinates for d3cgwa_:

Click to download the PDB-style file with coordinates for d3cgwa_.
(The format of our PDB-style files is described here.)

Timeline for d3cgwa_: