![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Myosin Regulatory Chain [47527] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47529] (1 PDB entry) |
![]() | Domain d2mysc_: 2mys C: [17323] Other proteins in same PDB: d2mysa1, d2mysa2, d2mysb_ complexed with mg, so4 |
PDB Entry: 2mys (more details), 2.8 Å
SCOPe Domain Sequences for d2mysc_:
Sequence, based on SEQRES records: (download)
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaait feeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeve elmkgqedsngcinyeafvkhimsv
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkiaaitfeeflpmlqaa annkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeveelmkgqedsng cinyeafvkhimsv
Timeline for d2mysc_: