Lineage for d2mysc_ (2mys C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 769024Protein Myosin Regulatory Chain [47527] (2 species)
  7. 769040Species Chicken (Gallus gallus) [TaxId:9031] [47529] (1 PDB entry)
  8. 769041Domain d2mysc_: 2mys C: [17323]
    Other proteins in same PDB: d2mysa1, d2mysa2, d2mysb_
    complexed with mg, mly, so4

Details for d2mysc_

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
PDB Compounds: (C:) myosin

SCOP Domain Sequences for d2mysc_:

Sequence, based on SEQRES records: (download)

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}
aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaait
feeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeve
elmkgqedsngcinyeafvkhimsv

Sequence, based on observed residues (ATOM records): (download)

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}
aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkiaaitfeeflpmlqaa
annkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeveelmkgqedsng
cinyeafvkhimsv

SCOP Domain Coordinates for d2mysc_:

Click to download the PDB-style file with coordinates for d2mysc_.
(The format of our PDB-style files is described here.)

Timeline for d2mysc_: