SCOPe 2.08: Domain d3cglf_: 3cgl F:

Lineage for d3cglf_ (3cgl F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Discosoma striata [188537] (1 PDB entry)

8. Domain d3cglf_: 3cgl F: [173229]
   automated match to d1mova_
   complexed with na
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3cglf_

PDB Entry: 3cgl, 2.09 Å

PDB Description: crystal structure and raman studies of dsfp483, a cyan fluorescent protein from discosoma striata

PDB Compounds: (F:) GFP-like fluorescent chromoprotein dsFP483

SCOPe Domain Sequences for d3cglf_:

Sequence, based on SEQRES records:

>d3cglf_ d.22.1.1 (F:) automated matches {Discosoma striata}
gtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqfqygnkafvhhpdni
hdylklsfpegytwersmhfedgglccitndisltgncfyydikftglnfppngpvvqkk
ttgwepsterlyprdgvligdihhaltveggghyacdik

Sequence, based on observed residues (ATOM records):

>d3cglf_ d.22.1.1 (F:) automated matches {Discosoma striata}
gtfnhyftkgplpfgwhilcpwsmhfedglccitftglnfppngpvvqkkdihhaacdik

Timeline for d3cglf_:

• d3cglf_ first appeared in SCOPe 2.01
  
• d3cglf_ appears in SCOPe 2.07