![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Discosoma striata [188537] (1 PDB entry) |
![]() | Domain d3cgle_: 3cgl E: [173228] automated match to d1mova_ complexed with na |
PDB Entry: 3cgl (more details), 2.09 Å
SCOPe Domain Sequences for d3cgle_:
Sequence, based on SEQRES records: (download)
>d3cgle_ d.22.1.1 (E:) automated matches {Discosoma striata} vikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqfq ygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikftg lnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakka alkmpgyhyvdtklviwnndkefmkveeheiavarhhpfy
>d3cgle_ d.22.1.1 (E:) automated matches {Discosoma striata} vikeemlidlhlegtfhyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqfqyg nkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikftgln fppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakkaal kmpgyhyvdtklviwnndkefmkveeheiavarhhpfy
Timeline for d3cgle_: