| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (22 species) not a true protein |
| Species Discosoma striata [188537] (1 PDB entry) |
| Domain d3cglc_: 3cgl C: [173226] automated match to d1mova_ complexed with na |
PDB Entry: 3cgl (more details), 2.09 Å
SCOPe Domain Sequences for d3cglc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cglc_ d.22.1.1 (C:) automated matches {Discosoma striata}
svikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqf
qygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikft
glnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakk
aalkmpgyhyvdtklviwnndkefmkveeheiavarhhpfyep
Timeline for d3cglc_: