Lineage for d3cglb_ (3cgl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940397Species Discosoma striata [188537] (1 PDB entry)
  8. 2940399Domain d3cglb_: 3cgl B: [173225]
    automated match to d1mova_
    complexed with na

Details for d3cglb_

PDB Entry: 3cgl (more details), 2.09 Å

PDB Description: crystal structure and raman studies of dsfp483, a cyan fluorescent protein from discosoma striata
PDB Compounds: (B:) GFP-like fluorescent chromoprotein dsFP483

SCOPe Domain Sequences for d3cglb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cglb_ d.22.1.1 (B:) automated matches {Discosoma striata}
vikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqfq
ygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikftg
lnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakka
alkmpgyhyvdtklviwnndkefmkveeheiavarhhpfy

SCOPe Domain Coordinates for d3cglb_:

Click to download the PDB-style file with coordinates for d3cglb_.
(The format of our PDB-style files is described here.)

Timeline for d3cglb_: