Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Discosoma striata [188537] (1 PDB entry) |
Domain d3cgla_: 3cgl A: [173224] automated match to d1mova_ complexed with na |
PDB Entry: 3cgl (more details), 2.09 Å
SCOPe Domain Sequences for d3cgla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cgla_ d.22.1.1 (A:) automated matches {Discosoma striata} mscsksvikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhi lcpqfqygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyy dikftglnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktv yrakkaalkmpgyhyvdtklviwnndkefmkveeheiavarhhpfy
Timeline for d3cgla_: