Lineage for d1dflz_ (1dfl Z:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711076Protein Myosin Regulatory Chain [47527] (2 species)
  7. 2711077Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
    Uniprot P07291
  8. 2711093Domain d1dflz_: 1dfl Z: [17322]
    Other proteins in same PDB: d1dfla1, d1dfla2, d1dflb1, d1dflb2, d1dflw_, d1dfly_
    complexed with adp, ca, mg, vo4

Details for d1dflz_

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state
PDB Compounds: (Z:) myosin head

SCOPe Domain Sequences for d1dflz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dflz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
eiikltdlqedlegnvkyedfvkkvmagpyp

SCOPe Domain Coordinates for d1dflz_:

Click to download the PDB-style file with coordinates for d1dflz_.
(The format of our PDB-style files is described here.)

Timeline for d1dflz_: