Lineage for d3cftb_ (3cft B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939304Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 939305Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 939306Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 939327Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
    Uniprot P02766 31-143
  8. 939493Domain d3cftb_: 3cft B: [173216]
    automated match to d2roya_
    complexed with 5ns

Details for d3cftb_

PDB Entry: 3cft (more details), 1.87 Å

PDB Description: Crystal structure of human transthyretin in complex with 1-amino-5-naphthalene sulfonate
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3cftb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cftb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d3cftb_:

Click to download the PDB-style file with coordinates for d3cftb_.
(The format of our PDB-style files is described here.)

Timeline for d3cftb_: