SCOPe 2.04: Domain d3cfqb_: 3cfq B:

Lineage for d3cfqb_ (3cfq B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (190 PDB entries)
   Uniprot P02766 31-143

8. Domain d3cfqb_: 3cfq B: [173214]
   automated match to d2roya_
   complexed with dif

Details for d3cfqb_

PDB Entry: 3cfq, 2.09 Å

PDB Description: Crystal structure of human wild-type transthyretin in complex with diclofenac

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3cfqb_:

Sequence, based on SEQRES records:

>d3cfqb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Sequence, based on observed residues (ATOM records):

>d3cfqb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsprrytiaallspysysttavvtn

Timeline for d3cfqb_:

• d3cfqb_ first appeared in SCOPe 2.01
  
• d3cfqb_ appears in SCOPe 2.03
  
• d3cfqb_ appears in SCOPe 2.05
  
• d3cfqb_ appears in the current release, SCOPe 2.08