Lineage for d1dflx_ (1dfl X:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97470Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 97585Protein Myosin Regulatory Chain [47527] (2 species)
  7. 97586Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (5 PDB entries)
  8. 97591Domain d1dflx_: 1dfl X: [17321]
    Other proteins in same PDB: d1dfla1, d1dfla2, d1dflb1, d1dflb2, d1dflw_, d1dfly_

Details for d1dflx_

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state

SCOP Domain Sequences for d1dflx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dflx_ a.39.1.5 (X:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
eiikltdlqedlegnvkyedfvkkvmagpyp

SCOP Domain Coordinates for d1dflx_:

Click to download the PDB-style file with coordinates for d1dflx_.
(The format of our PDB-style files is described here.)

Timeline for d1dflx_: