Lineage for d3cfij_ (3cfi J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509562Family d.24.1.7: GSPII I/J protein-like [160135] (2 protein domains)
    Pfam PF02501
  6. 2509563Protein Pseudopilin EpsI [160136] (1 species)
  7. 2509564Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries)
    Uniprot Q7MPZ1 63-143
  8. 2509568Domain d3cfij_: 3cfi J: [173207]
    Other proteins in same PDB: d3cfib_, d3cfic1, d3cfic2, d3cfie_, d3cfif1, d3cfif2, d3cfih_, d3cfii1, d3cfii2, d3cfik_, d3cfil1, d3cfil2
    automated match to d2reta1
    complexed with cl

Details for d3cfij_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (J:) Type II secretory pathway, pseudopilin EpsI

SCOPe Domain Sequences for d3cfij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfij_ d.24.1.7 (J:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
afdvsvaaekqaspiitvrsy

SCOPe Domain Coordinates for d3cfij_:

Click to download the PDB-style file with coordinates for d3cfij_.
(The format of our PDB-style files is described here.)

Timeline for d3cfij_: