Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.5: EpsJ-like [160127] (2 proteins) automatically mapped to Pfam PF11612 |
Protein Type II secretory pathway component EpsJ [160128] (1 species) |
Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries) Uniprot Q7MPZ0 48-213 |
Domain d3cfih_: 3cfi H: [173206] Other proteins in same PDB: d3cfia_, d3cfic_, d3cfid_, d3cfif_, d3cfig_, d3cfii_, d3cfij_, d3cfil_ automated match to d2retb1 complexed with cl |
PDB Entry: 3cfi (more details), 2.58 Å
SCOPe Domain Sequences for d3cfih_:
Sequence, based on SEQRES records: (download)
>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]} elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr fydgkqwinewsneltlpaaisveltlkdygkiartyltp
>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]} elsqertarlnelqralvmmdsdfrqialrqtrtngekkllhwadylldsdnkgimfarl gwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfyd gkqwinewsneltlpaaisveltlkdygkiartyltp
Timeline for d3cfih_: