Lineage for d3cfih_ (3cfi H:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022488Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1022489Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1022556Family d.24.1.5: EpsJ-like [160127] (2 proteins)
  6. 1022560Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 1022561Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 1022568Domain d3cfih_: 3cfi H: [173206]
    Other proteins in same PDB: d3cfia_, d3cfid_, d3cfig_, d3cfij_
    automated match to d2retb1
    complexed with cl

Details for d3cfih_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (H:) Type II secretory pathway, PSEUDOPILIN EpsJ

SCOPe Domain Sequences for d3cfih_:

Sequence, based on SEQRES records: (download)

>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltp

Sequence, based on observed residues (ATOM records): (download)

>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngekkllhwadylldsdnkgimfarl
gwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfyd
gkqwinewsneltlpaaisveltlkdygkiartyltp

SCOPe Domain Coordinates for d3cfih_:

Click to download the PDB-style file with coordinates for d3cfih_.
(The format of our PDB-style files is described here.)

Timeline for d3cfih_: